Recombinant Human Cytomegalovirus UL131 Protein (1-76 aa), His-tagged

• Cat.No.: UL131-2103H
• Product Overview: Recombinant Human Cytomegalovirus (strain AD169) (HHV-5) (HCMV) UL131 Protein (1-76 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Human Cytomegalovirus
• Source: E.coli
• Tag: His
• ProteinLength: 1-76 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.7 kDa
• AA Sequence: MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: UL131
• UniProt ID: P16773