Recombinant Human CYTL1 Protein, GST-tagged

• Cat.No.: CYTL1-2307H
• Product Overview: Human CYTL1 full-length ORF ( AAH31391, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 (MIM 142230) surface marker (Liu et al., 2000 [PubMed 10857752]).[supplied by OMIM, Mar 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.7 kDa
• AA Sequence: MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTALPDRQR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYTL1 cytokine like 1 [ Homo sapiens (human) ]
• Official Symbol: CYTL1
• Synonyms: CYTL1; cytokine like 1; Cytokine Like 1; C4orf4; Cytokine-Like Protein C17; Cytokine-Like Protein 1; Cytokine-Like 1; Protein C17; C17; cytokine-like protein 1; cytokine-like protein C17
• Gene ID: 54360
• mRNA Refseq: NM_018659
• Protein Refseq: NP_061129
• MIM: 607930
• UniProt ID: Q9NRR1