Recombinant Human CYP4X1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CYP4X1-3110H |
Product Overview : | CYP4X1 MS Standard C13 and N15-labeled recombinant protein (NP_828847) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes and is located within a cluster of genes belonging to this superfamily on chromosome 1. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 58.9 kDa |
AA Sequence : | MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNHFILKPKNGMYLHLKKLSECTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CYP4X1 cytochrome P450 family 4 subfamily X member 1 [ Homo sapiens (human) ] |
Official Symbol | CYP4X1 |
Synonyms | CYP4X1; cytochrome P450, family 4, subfamily X, polypeptide 1; cytochrome P450 4X1; MGC40051; CYPIVX1; |
Gene ID | 260293 |
mRNA Refseq | NM_178033 |
Protein Refseq | NP_828847 |
MIM | 614999 |
UniProt ID | Q8N118 |
◆ Recombinant Proteins | ||
CYP4X1-11793H | Recombinant Human CYP4X1, His-tagged | +Inquiry |
CYP4X1-1414R | Recombinant Rat CYP4X1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cyp4x1-2423M | Recombinant Mouse Cyp4x1 Protein, Myc/DDK-tagged | +Inquiry |
CYP4X1-2161M | Recombinant Mouse CYP4X1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP4X1-2288H | Recombinant Human CYP4X1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP4X1-441HCL | Recombinant Human CYP4X1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP4X1 Products
Required fields are marked with *
My Review for All CYP4X1 Products
Required fields are marked with *
0
Inquiry Basket