Recombinant Human CYP2C8, GST-tagged

Cat.No. : CYP2C8-120H
Product Overview : Human CYP2C8 full-length ORF ( AAH20596.1, 1 a.a. - 490 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 490 a.a.
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, benzo(a)pyrene, 7-ethyoxycoumarin, and the anti-cancer drug taxol. This gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. Several transcript variants encoding a few different isoforms have been found for this gene.
Molecular Mass : 82.2 kDa
AA Sequence : MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIV VFHGYESVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAH CLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDC FPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTK FRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLT TILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYP2C8 cytochrome P450, family 2, subfamily C, polypeptide 8 [Homo sapiens (human) ]
Official Symbol CYP2C8
Synonyms CYP2C8; CPC8; CYPIIC8; MP-12/MP-20; cytochrome P450, family 2, subfamily C, polypeptide 8; cytochrome P450 2C8; P450 form 1; cytochrome P450 IIC2; cytochrome P450 MP-12; cytochrome P450 MP-20; cytochrome P450 form 1; microsomal monooxygenase; xenobiotic monooxygenase; s-mephenytoin 4-hydroxylase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 8; EC 1.14.14.1
Gene ID 1558
mRNA Refseq NM_000770
Protein Refseq NP_000761
MIM 601129
UniProt ID P10632
Chromosome Location 10q23.33
Pathway Arachidonate Epoxygenase / Epoxide Hydrolase; Arachidonic acid metabolism; Biological oxidations
Function aromatase activity; caffeine oxidase activity; electron carrier activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CYP2C8 Products

Required fields are marked with *

My Review for All CYP2C8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon