Recombinant Human CYP27A1 Protein, GST-tagged
Cat.No. : | CYP27A1-2253H |
Product Overview : | Human CYP27A1 full-length ORF ( NP_000775.1, 1 a.a. - 531 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 86.6 kDa |
AA Sequence : | MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP27A1 cytochrome P450, family 27, subfamily A, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP27A1 |
Synonyms | CYP27A1; cytochrome P450, family 27, subfamily A, polypeptide 1; CYP27, cytochrome P450, subfamily XXVIIA (steroid 27 hydroxylase, cerebrotendinous xanthomatosis), polypeptide 1; sterol 26-hydroxylase, mitochondrial; cerebrotendinous xanthomatosis; CP27; CTX; cytochrome P450 27; sterol 27-hydroxylase; cytochrome P-450C27/25; vitamin D(3) 25-hydroxylase; cholestanetriol 26-monooxygenase; 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase; 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase; cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinous xanthomatosis), polypeptide 1; CYP27; |
Gene ID | 1593 |
mRNA Refseq | NM_000784 |
Protein Refseq | NP_000775 |
MIM | 606530 |
UniProt ID | Q02318 |
◆ Recombinant Proteins | ||
CYP27A1-701H | Recombinant Human CYP27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP27A1-2131M | Recombinant Mouse CYP27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP27A1-1141R | Recombinant Rhesus monkey CYP27A1 Protein, His-tagged | +Inquiry |
CYP27A1-2338HF | Recombinant Full Length Human CYP27A1 Protein, GST-tagged | +Inquiry |
Cyp27a1-250M | Recombinant Mouse Cyp27a1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP27A1-7119HCL | Recombinant Human CYP27A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP27A1 Products
Required fields are marked with *
My Review for All CYP27A1 Products
Required fields are marked with *
0
Inquiry Basket