Recombinant Human CYP1B1 protein, GST-tagged
Cat.No. : | CYP1B1-28190TH |
Product Overview : | Recombinant Human CYP1B1(NP_000095, 453 a.a. - 542 a.a.) protein fused with GST-tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC |
Applications : | AP; Array; ELISA; WB-Re |
Notes : | Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. |
Gene Name | Cytochrome P450 family 1 subfamily B member 1 [Homo sapiens (human)] |
Official Symbol | CYP1B1 |
Synonyms | CP1B; ASGD6; GLC3A; CYPIB1; P4501B1 |
Gene ID | 1545 |
mRNA Refseq | NM_000104.3 |
Protein Refseq | NP_000095.2 |
MIM | 601771 |
UniProt ID | Q16678 |
◆ Recombinant Proteins | ||
CYP1B1-2127M | Recombinant Mouse CYP1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP1B1-1903H | Recombinant Human CYP1B1 Protein (Leu224-Asp492), GST tagged | +Inquiry |
CYP1B1-1902H | Recombinant Human CYP1B1 Protein (Leu224-Asp492), C-His tagged | +Inquiry |
CYP1B1-1939R | Recombinant Rat CYP1B1 Protein (1-543 aa), His-tagged | +Inquiry |
CYP1B1-1376R | Recombinant Rat CYP1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP1B1-7125HCL | Recombinant Human CYP1B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP1B1 Products
Required fields are marked with *
My Review for All CYP1B1 Products
Required fields are marked with *
0
Inquiry Basket