Recombinant Human CYP1B1 protein, GST-tagged

Cat.No. : CYP1B1-28190TH
Product Overview : Recombinant Human CYP1B1(NP_000095, 453 a.a. - 542 a.a.) protein fused with GST-tag at N-terminal was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.64 kDa
AA Sequence : NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC
Applications : AP; Array; ELISA; WB-Re
Notes : Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade.
Gene Name Cytochrome P450 family 1 subfamily B member 1 [Homo sapiens (human)]
Official Symbol CYP1B1
Synonyms CP1B; ASGD6; GLC3A; CYPIB1; P4501B1
Gene ID 1545
mRNA Refseq NM_000104.3
Protein Refseq NP_000095.2
MIM 601771
UniProt ID Q16678

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CYP1B1 Products

Required fields are marked with *

My Review for All CYP1B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon