Recombinant Human CYP1B1 protein, GST-tagged

• Cat.No.: CYP1B1-28190TH
• Product Overview: Recombinant Human CYP1B1(NP_000095, 453 a.a. - 542 a.a.) protein fused with GST-tag at N-terminal was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.64 kDa
• AA Sequence: NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC
• Applications: AP; Array; ELISA; WB-Re
• Notes: Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade.

Gene Information

• Gene Name: Cytochrome P450 family 1 subfamily B member 1 [Homo sapiens (human)]
• Official Symbol: CYP1B1
• Synonyms: CP1B; ASGD6; GLC3A; CYPIB1; P4501B1
• Gene ID: 1545
• mRNA Refseq: NM_000104.3
• Protein Refseq: NP_000095.2
• MIM: 601771
• UniProt ID: Q16678