Recombinant Human CYP17A1 protein, His-tagged
Cat.No. : | CYP17A1-3622H |
Product Overview : | Recombinant Human CYP17A1 protein(160-508 aa), fused to His tag, was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 160-508 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CYP17A1 cytochrome P450, family 17, subfamily A, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP17A1 |
Synonyms | CYP17A1; cytochrome P450, family 17, subfamily A, polypeptide 1; CYP17, cytochrome P450, subfamily XVII (steroid 17 alpha hydroxylase), adrenal hyperplasia; steroid 17-alpha-hydroxylase/17,20 lyase; CPT7; P450C17; S17AH; Steroid 17 alpha monooxygenase; CYPXVII; cytochrome P450c17; cytochrome P450-C17; cytochrome P450 17A1; cytochrome p450 XVIIA1; steroid 17-alpha-monooxygenase; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; CYP17; |
Gene ID | 1586 |
mRNA Refseq | NM_000102 |
Protein Refseq | NP_000093 |
MIM | 609300 |
UniProt ID | P05093 |
◆ Recombinant Proteins | ||
CYP17A1-02H | Active Recombinant Human CYP17A1 Protein | +Inquiry |
CYP17A1-1714R | Recombinant Rat CYP17A1 Protein | +Inquiry |
CYP17A1-2786H | Recombinant Human CYP17A1 protein, GST-tagged | +Inquiry |
CYP17A1-3622H | Recombinant Human CYP17A1 protein, His-tagged | +Inquiry |
CYP17A1-2115H | Recombinant Human CYP17A1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP17A1-7128HCL | Recombinant Human CYP17A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP17A1 Products
Required fields are marked with *
My Review for All CYP17A1 Products
Required fields are marked with *
0
Inquiry Basket