Recombinant Human CYP11A1 protein, GST-tagged

• Cat.No.: CYP11A1-7132H
• Product Overview: Recombinant Human CYP11A1(1 a.a. - 521 a.a.), fussed with GST tag at N-terminal, was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 521 a.a.
• Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 86.5 kDa
• AA Sequence: MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVH LHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKD RVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEV VNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVP LLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYF RNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CYP11A1 cytochrome P450, family 11, subfamily A, polypeptide 1 [ Homo sapiens ]
• Official Symbol: CYP11A1
• Synonyms: CYP11A1; cytochrome P450, family 11, subfamily A, polypeptide 1; CYP11A, cytochrome P450, subfamily XIA (cholesterol side chain cleavage); cholesterol side-chain cleavage enzyme, mitochondrial; cholesterol monooxygenase (side chain cleaving); P450SCC; steroid 20-22-lyase; cytochrome P450 11A1; cytochrome P450(scc); cytochrome P450C11A1; cholesterol 20-22 desmolase; cholesterol monooxygenase (side-chain cleaving); cytochrome P450, subfamily XIA (cholesterol side chain cleavage); CYP11A; CYPXIA1
• Gene ID: 1583
• mRNA Refseq: NM_001099773
• Protein Refseq: NP_001093243
• MIM: 118485
• UniProt ID: P05108
• Chromosome Location: 15q23-q24
• Pathway: Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; Endogenous sterols, organism-specific biosystem; Glucocorticoid andamp; Mineralcorticoid Metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem
• Function: cholesterol binding; cholesterol monooxygenase (side-chain-cleaving) activity; cholesterol monooxygenase (side-chain-cleaving) activity; electron carrier activity; heme binding; metal ion binding; monooxygenase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen