Recombinant Human CYLC2 Protein, GST-tagged

• Cat.No.: CYLC2-2236H
• Product Overview: Human CYLC2 full-length ORF (BAG36151.1, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cylicin II (CYCL2) is specifically expressed in testis and is part of the cytoskeletal calyx of mammalian sperm heads. Cylicin II may play a role in the morphogenesis of the sperm head. [provided by RefSeq, Jul 2008]
• Molecular Mass: 64.68 kDa
• AA Sequence: MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSSTDSDSKDDVKKESKKDATKDAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYLC2 cylicin, basic protein of sperm head cytoskeleton 2 [ Homo sapiens ]
• Official Symbol: CYLC2
• Synonyms: CYLC2; cylicin, basic protein of sperm head cytoskeleton 2; cylicin-2; cylicin II; multiple-band polypeptide II; MGC129591
• Gene ID: 1539
• mRNA Refseq: NM_001340
• Protein Refseq: NP_001331
• MIM: 604035
• UniProt ID: Q14093