Recombinant Human CYCS, His-tagged

• Cat.No.: CYCS-75H
• Product Overview: Recombinant Human Cytochrome C/CYCS is produced with our E. coli expression system. The target protein is expressed with sequence (Gly2-Glu105) of Human CYCS fused with a 6His tag at the C-terminus.

Specification

• Description: Cytochrome C (CYCS) is a small heme protein that belongs to the cytochrome c family. It is found loosely associated with the inner membrane of the mitochondrion. Cytochrome C is a highly soluble protein that functions as a central component of the electron transport chain in mitochondria. CYCS transfers electrons between Complexes III (Coenzyme Q - Cyt C reductase) and IV (Cyt C oxidase). CYCS plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of Cytochrome C to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris, 0.15M NaCl, 20% Glycerol, pH 8.0
• AA Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTL MEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNELEHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.
• Protein length: 2-105 a.a.

Gene Information

• Gene Name: CYCS cytochrome c, somatic [ Homo sapiens ]
• Official Symbol: CYCS
• Synonyms: CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4
• Gene ID: 54205
• mRNA Refseq: NM_018947
• Protein Refseq: NP_061820
• MIM: 123970
• UniProt ID: P99999
• Chromosome Location: 7p21.2
• Pathway: Activation of caspases through apoptosome-mediated cleavage, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem
• Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; heme binding; metal ion binding; protein binding; contributes_to protein serine/threonine phosphatase activity