Recombinant Human CYB5D2 Protein, GST-tagged
Cat.No. : | CYB5D2-2213H |
Product Overview : | Human CYB5D2 full-length ORF (BAD18808.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CYB5D2 (Cytochrome B5 Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include heme binding. An important paralog of this gene is NENF. |
Molecular Mass : | 55.1 kDa |
AA Sequence : | MLRCGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEANKLQLQEKQTFPPCNAEWSSARGSRLWCSQKSGGVSRDWIGVPRKLYKPGAKEPRCVCVRTTGPPSGQMPDNPPHRNRGDLDHPNLAEYTGCPPLAITCSFPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYB5D2 cytochrome b5 domain containing 2 [ Homo sapiens ] |
Official Symbol | CYB5D2 |
Synonyms | CYB5D2; cytochrome b5 domain containing 2; neuferricin; MGC32124; cytochrome b5 domain-containing protein 2; |
Gene ID | 124936 |
mRNA Refseq | NM_001254755 |
Protein Refseq | NP_001241684 |
UniProt ID | Q8WUJ1 |
◆ Recombinant Proteins | ||
CYB5D2-2213H | Recombinant Human CYB5D2 Protein, GST-tagged | +Inquiry |
CYB5D2-950R | Recombinant Rhesus Macaque CYB5D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5D2-1125R | Recombinant Rhesus monkey CYB5D2 Protein, His-tagged | +Inquiry |
CYB5D2-4124M | Recombinant Mouse CYB5D2 Protein | +Inquiry |
CYB5D2-2380HF | Recombinant Full Length Human CYB5D2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5D2-212HCL | Recombinant Human CYB5D2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYB5D2 Products
Required fields are marked with *
My Review for All CYB5D2 Products
Required fields are marked with *
0
Inquiry Basket