Recombinant Human CYB5B protein, His-tagged
Cat.No. : | CYB5B-3621H |
Product Overview : | Recombinant Human CYB5B protein(1-110 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-110 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ] |
Official Symbol | CYB5B |
Synonyms | CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619; |
Gene ID | 80777 |
mRNA Refseq | NM_030579 |
Protein Refseq | NP_085056 |
MIM | 611964 |
UniProt ID | O43169 |
◆ Recombinant Proteins | ||
CYB5B-1123R | Recombinant Rhesus monkey CYB5B Protein, His-tagged | +Inquiry |
CYB5B-12135Z | Recombinant Zebrafish CYB5B | +Inquiry |
CYB5B-11745H | Recombinant Human CYB5B protein, GST-tagged | +Inquiry |
CYB5B-2214H | Recombinant Human CYB5B Protein, GST-tagged | +Inquiry |
RFL3123MF | Recombinant Full Length Mouse Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is there an iron or heme content for this particular product?
12/01/2023
The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.
Ask a Question for All CYB5B Products
Required fields are marked with *
My Review for All CYB5B Products
Required fields are marked with *
0
Inquiry Basket