Recombinant Human CYB5B Protein, GST-tagged
Cat.No. : | CYB5B-2214H |
Product Overview : | Human CYB5-M full-length ORF ( AAH04373.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-146 a.a. |
Description : | CYB5B (Cytochrome B5 Type B) is a Protein Coding gene. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. GO annotations related to this gene include heme binding and enzyme activator activity. An important paralog of this gene is CYB5A. |
Molecular Mass : | 42.7 kDa |
AA Sequence : | MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ] |
Official Symbol | CYB5B |
Synonyms | CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619; |
Gene ID | 80777 |
mRNA Refseq | NM_030579 |
Protein Refseq | NP_085056 |
MIM | 611964 |
UniProt ID | O43169 |
◆ Recombinant Proteins | ||
CYB5B-1123R | Recombinant Rhesus monkey CYB5B Protein, His-tagged | +Inquiry |
CYB5B-2294C | Recombinant Chicken CYB5B | +Inquiry |
CYB5B-2382HF | Recombinant Full Length Human CYB5B Protein, GST-tagged | +Inquiry |
CYB5B-11745H | Recombinant Human CYB5B protein, GST-tagged | +Inquiry |
CYB5B-948R | Recombinant Rhesus Macaque CYB5B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Is there an iron or heme content for this particular product?
12/01/2023
The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.
Ask a Question for All CYB5B Products
Required fields are marked with *
My Review for All CYB5B Products
Required fields are marked with *
0
Inquiry Basket