Recombinant Human CYB5A Protein, GST-tagged
Cat.No. : | CYB5A-2208H |
Product Overview : | Human CYB5 full-length ORF ( AAH15182, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 40.48 kDa |
AA Sequence : | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ] |
Official Symbol | CYB5A |
Synonyms | CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5; type 1 cyt-b5; CYB5; MCB5; |
Gene ID | 1528 |
mRNA Refseq | NM_001190807 |
Protein Refseq | NP_001177736 |
MIM | 613218 |
UniProt ID | P00167 |
◆ Recombinant Proteins | ||
CYB5A-2374HF | Recombinant Full Length Human CYB5A Protein, GST-tagged | +Inquiry |
CYB5A-1359R | Recombinant Rat CYB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13957GF | Recombinant Full Length Chicken Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
CYB5A-11744H | Recombinant Human CYB5A, GST-tagged | +Inquiry |
CYB5A-12352Z | Recombinant Zebrafish CYB5A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYB5A Products
Required fields are marked with *
My Review for All CYB5A Products
Required fields are marked with *
0
Inquiry Basket