Recombinant Full Length Human CYB5A Protein, C-Flag-tagged

• Cat.No.: CYB5A-1662HFL
• Product Overview: Recombinant Full Length Human CYB5A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 15.1 kDa
• AA Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: CYB5A cytochrome b5 type A [ Homo sapiens (human) ]
• Official Symbol: CYB5A
• Synonyms: CYB5; MCB5; METAG
• Gene ID: 1528
• mRNA Refseq: NM_148923.4
• Protein Refseq: NP_683725.1
• MIM: 613218
• UniProt ID: P00167