Recombinant Human CYB5A, His-tagged

• Cat.No.: CYB5A-27557TH
• Product Overview: Recombinant full length Human Cytochrome b5 expressed in Saccharomyces cerevisiae; amino acids 1-98 , 11.3kDa.

Specification

• Species: Human
• Tag: His
• Protein Length: 1-98 a.a.
• Description: The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKF LEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFI IGELHPDDRPKLNKPPEP
• Sequence Similarities: Belongs to the cytochrome b5 family.Contains 1 cytochrome b5 heme-binding domain.
• Full Length: Full L.

Gene Information

• Gene Name: CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ]
• Official Symbol: CYB5A
• Synonyms: CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5
• Gene ID: 1528
• mRNA Refseq: NM_001190807
• Protein Refseq: NP_001177736
• MIM: 613218
• Uniprot ID: P00167
• Chromosome Location: 18q23
• Pathway: Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin C (ascorbate) metabolism, organism-specific biosystem; gamma-linolenate biosynthesis II (animals), conserved biosystem
• Function: aldo-keto reductase (NADP) activity; cytochrome-c oxidase activity; enzyme binding; heme binding; metal ion binding