Recombinant Human CYB561D1 Protein, GST-tagged

• Cat.No.: CYB561D1-2210H
• Product Overview: Human CYB561D1 full-length ORF (BAC04767.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CYB561D1 (Cytochrome B561 Family Member D1) is a Protein Coding gene. An important paralog of this gene is CYB561D2.
• Molecular Mass: 51.8 kDa
• AA Sequence: MQPLEVGLVPAPAGEPRLTRWLRRGSGILAHLVALGFTIFLTALSRPGTSLFSWHPVFMALAFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRTRSELPHLVSWHSWVGALTLLATAVQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKGAAWYLCLALPVYPALVIMHQISRSYLPRKKMEM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CYB561D1 cytochrome b-561 domain containing 1 [ Homo sapiens ]
• Official Symbol: CYB561D1
• Synonyms: RP5-831G13.3
• Gene ID: 284613
• mRNA Refseq: NM_182580.2
• Protein Refseq: NP_872386.1
• UniProt ID: Q8N8Q1