Recombinant Human CXorf38 Protein, GST-tagged

• Cat.No.: CXorf38-2192H
• Product Overview: Human CXorf38 full-length ORF ( NP_659407.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CXorf38 (Chromosome X Open Reading Frame 38) is a Protein Coding gene.
• Molecular Mass: 63.1 kDa
• AA Sequence: MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXorf38 chromosome X open reading frame 38 [ Homo sapiens ]
• Official Symbol: CXorf38
• Synonyms: CXORF38; chromosome X open reading frame 38; uncharacterized protein CXorf38; MGC39350
• Gene ID: 159013
• mRNA Refseq: NM_144970
• Protein Refseq: NP_659407
• UniProt ID: Q8TB03