Recombinant Human CXCR2 protein, His-SUMO-tagged

• Cat.No.: CXCR2-3110H
• Product Overview: Recombinant Human CXCR2 protein(P25025)(1-40aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.6 kDa
• Protein length: 1-40aa
• AA Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CXCR2 chemokine (C-X-C motif) receptor 2 [ Homo sapiens ]
• Official Symbol: CXCR2
• Synonyms: CXCR2; chemokine (C-X-C motif) receptor 2; IL8RB, interleukin 8 receptor, beta; C-X-C chemokine receptor type 2; CD182; CMKAR2; CXC-R2; CXCR-2; IL-8R B; GRO/MGSA receptor; IL-8 receptor type 2; interleukin 8 receptor B; chemokine (CXC) receptor 2; interleukin 8 receptor, beta; interleukin 8 receptor type 2; interleukin-8 receptor type B; CXCR2 gene for IL8 receptor type B; high affinity interleukin-8 receptor B; IL8R2; IL8RA; IL8RB; CDw128b
• Gene ID: 3579
• mRNA Refseq: NM_001168298
• Protein Refseq: NP_001161770
• MIM: 146928
• UniProt ID: P25025