Recombinant Human CXCL6 protein

Cat.No. : CXCL6-75H
Product Overview : Recombinant Human CXCL6 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family that is also known as granulocyte chemotactic protein 2 (GCP-2). As its former name suggests, CXCL6 is a chemoattractant for neutrophilic granulocytes. It elicits its chemotactic effects by interacting with the chemokine receptors CXCR1 and CXCR2. The gene for CXCL6 is located on human chromosome 4 in a cluster with other CXC chemokine genes.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-50 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids.
Protein length : 72
AA Sequence : VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Endotoxin : Less than 0.1 EU/µg of rHuGCP-2/CXCL6 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag : Non
Gene Name CXCL6
Official Symbol CXCL6
Synonyms CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2; chemokine alpha 3; small-inducible cytokine B6; granulocyte chemotactic protein 2; Small inducible cytokine subfamily B (Cys-X-Cys), member b; small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2); GCP2; CKA-3; GCP-2; SCYB6;
Gene ID 6372
mRNA Refseq NM_002993
Protein Refseq NP_002984
MIM 138965
UniProt ID P80162

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL6 Products

Required fields are marked with *

My Review for All CXCL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon