Recombinant Human CXCL6 protein
Cat.No. : | CXCL6-75H |
Product Overview : | Recombinant Human CXCL6 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family that is also known as granulocyte chemotactic protein 2 (GCP-2). As its former name suggests, CXCL6 is a chemoattractant for neutrophilic granulocytes. It elicits its chemotactic effects by interacting with the chemokine receptors CXCR1 and CXCR2. The gene for CXCL6 is located on human chromosome 4 in a cluster with other CXC chemokine genes. |
Source : | E.coli |
Species : | Human |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-50 ng/ml. |
Molecular Mass : | Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids. |
Protein length : | 72 |
AA Sequence : | VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Endotoxin : | Less than 0.1 EU/µg of rHuGCP-2/CXCL6 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Tag : | Non |
Gene Name | CXCL6 |
Official Symbol | CXCL6 |
Synonyms | CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2; chemokine alpha 3; small-inducible cytokine B6; granulocyte chemotactic protein 2; Small inducible cytokine subfamily B (Cys-X-Cys), member b; small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2); GCP2; CKA-3; GCP-2; SCYB6; |
Gene ID | 6372 |
mRNA Refseq | NM_002993 |
Protein Refseq | NP_002984 |
MIM | 138965 |
UniProt ID | P80162 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CXCL6 Products
Required fields are marked with *
My Review for All CXCL6 Products
Required fields are marked with *
0
Inquiry Basket