Recombinant Human CXCL5 protein, His-tagged
Cat.No. : | CXCL5-2772H |
Product Overview : | Recombinant Human CXCL5 protein(P42830)(37-110aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 37-110aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 11.9 kDa |
AA Sequence : | AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ] |
Official Symbol | CXCL5 |
Synonyms | CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78; |
Gene ID | 6374 |
mRNA Refseq | NM_002994 |
Protein Refseq | NP_002985 |
MIM | 600324 |
UniProt ID | P42830 |
◆ Recombinant Proteins | ||
CXCL5-151H | Active Recombinant Human CXCL5 protein | +Inquiry |
CXCL5-234H | Recombinant Human X-C motif chemokine ligand 5 Protein, Tag Free | +Inquiry |
Cxcl5-98M | Recombinant Mouse Cxcl5 protein | +Inquiry |
CXCL5-1350R | Recombinant Rat CXCL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL5-2298HF | Recombinant Full Length Human CXCL5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL5-7167HCL | Recombinant Human CXCL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL5 Products
Required fields are marked with *
My Review for All CXCL5 Products
Required fields are marked with *
0
Inquiry Basket