Recombinant Human CXCL5 protein

• Cat.No.: CXCL5-12H
• Product Overview: Recombinant Human CXCL5 protein (5-78 a.a.) was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 74
• Description: CXCL5 is a small cytokine also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). The gene for human CXCL5 is encoded by four exons which belong to CXCL5 gene located on human chromosome 4. The protein is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. They are produced by proteolytic cleavage after secretion from peripheral blood monocytes. Recombinant human CXCL5 (5-78 a.a.) contains 74 amino acids and it is a single non-glycosylated polypeptide chain. Human CXCL5 shares 57 % amino acid sequence identity with mouse and rat CXCL5.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 5.0-10 ng/ml.
• Molecular Mass: Approximately 8.1 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
• Endotoxin: Less than 1 EU/μg of rHuENA-78, 5-78a.a./CXCL5 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CXCL5
• Official Symbol: CXCL5
• Synonyms: CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78
• Gene ID: 6374
• mRNA Refseq: NM_002994
• Protein Refseq: NP_002985
• MIM: 600324
• UniProt ID: P42830