Recombinant Human CXCL13 protein, His-tagged

Cat.No. : CXCL13-2771H
Product Overview : Recombinant Human CXCL13 protein(O43927)(23-95aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 23-95aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 12.8 kDa
AA Sequence : VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CXCL13 chemokine (C-X-C motif) ligand 13 [ Homo sapiens ]
Official Symbol CXCL13
Synonyms CXCL13; chemokine (C-X-C motif) ligand 13; SCYB13, small inducible cytokine B subfamily (Cys X Cys motif), member 13 (B cell chemoattractant); C-X-C motif chemokine 13; ANGIE; ANGIE2; B cell chemoattractant; BCA 1; BLC; BLR1L; CXC chemokine BLC; B-cell chemoattractant; B-lymphocyte chemoattractant; b lymphocyte chemoattractant; small-inducible cytokine B13; B-cell-attracting chemokine 1; b cell-attracting chemokine 1; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); B-cell-homing chemokine (ligand for Burkitts lymphoma receptor-1); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); BCA1; BCA-1; SCYB13;
Gene ID 10563
mRNA Refseq NM_006419
Protein Refseq NP_006410
MIM 605149
UniProt ID O43927

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL13 Products

Required fields are marked with *

My Review for All CXCL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon