Active Recombinant Mouse Cxcl13 Protein

• Cat.No.: Cxcl13-149M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 13 (Cxcl13) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Strongly chemotactic for B-lymphocytes, weakly for spleen monocytes and macrophages but no chemotactic activity for granulocytes. Binds to BLR1/CXCR5. May play a role in directing the migration of B-lymphocytes to follicles in secondary lymphoid organs.
• Bio-activity: Determined by its ability to chemoattract murine B cells using a concentration of 10.0-100.0 ng/ml.
• Molecular Mass: 9.8 kDa
• AA Sequence: ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Cxcl13 chemokine (C-X-C motif) ligand 13 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl13
• Synonyms: Cxcl13; chemokine (C-X-C motif) ligand 13; BLC; Angie; BCA-1; BLR1L; ANGIE2; Scyb13; 4631412M08Rik; C-X-C motif chemokine 13; B lymphocyte chemoattractant; CXC chemokine BLC; small inducible cytokine subfamily B (Cys-X-Cys), member 13; small-inducible cytokine B13
• Gene ID: 55985
• mRNA Refseq: NM_018866
• Protein Refseq: NP_061354
• UniProt ID: O55038