Recombinant Human CXCL11 protein
Cat.No. : | CXCL11-280H |
Product Overview : | Recombinant Human CXCL11 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 73 |
Description : | CXCL11 also known as I-TAC is belonging to the CXC chemokine family and shares 36 % and 37 % amino acid sequence homology with IP-10 and MIG, respectively. It is highly expressed in peripheral blood leukocytes, pancreas and liver. Expression of CXCL11 is strongly induced by IFN-γ and IFN-β, and weakly induced by IFN-α. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3, which with a higher affinity than do the other chemokines for this receptor, CXCL9 and CXCL10. Similar to CXCL10, CXCL11 has been shown to be a chemoattractant for IL-2-activated T-lymphocytes, but not for isolated T-cells, neutrophils or monocytes. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human IL-2 activated human T-lymphocytes is in a concentration range of 0.1-10 ng/ml. |
Molecular Mass : | Approximately 8.3 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Endotoxin : | Less than 1 EU/µg of rHuI-TAC/CXCL11 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL11 |
Official Symbol | CXCL11 |
Synonyms | CXCL11; chemokine (C-X-C motif) ligand 11; SCYB9B, SCYB11, small inducible cytokine subfamily B (Cys X Cys), member 11; C-X-C motif chemokine 11; b R1; H174; I TAC; IP 9; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; IP9; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; MGC102770; |
Gene ID | 6373 |
mRNA Refseq | NM_005409 |
Protein Refseq | NP_005400 |
MIM | 604852 |
UniProt ID | O14625 |
◆ Recombinant Proteins | ||
CXCL11-036H | Recombinant Human CXCL11 Protein, Fc-tagged | +Inquiry |
CXCL11-134B | Recombinant Bovine Chemokine (C-X-C motif) Ligand 11 | +Inquiry |
CXCL11-4099M | Recombinant Mouse CXCL11 Protein | +Inquiry |
Cxcl11-253M | Active Recombinant Mouse Cxcl11 Protein (Phe22-Met110), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL11-168H | Active Recombinant Human Chemokine (C-X-C Motif) Ligand 11, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL11-7171HCL | Recombinant Human CXCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL11 Products
Required fields are marked with *
My Review for All CXCL11 Products
Required fields are marked with *
0
Inquiry Basket