Recombinant Human CUZD1 protein, GST-tagged
Cat.No. : | CUZD1-1232H |
Product Overview : | Recombinant Human CUZD1 protein(523-568 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 523-568 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | DISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQPFNS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CUZD1 CUB and zona pellucida-like domains 1 [ Homo sapiens ] |
Official Symbol | CUZD1 |
Synonyms | ERG-1; UO-44 |
Gene ID | 50624 |
mRNA Refseq | NM_022034.5 |
Protein Refseq | NP_071317.2 |
UniProt ID | Q86UP6 |
◆ Recombinant Proteins | ||
CUZD1-1551H | Recombinant Human CUZD1 protein, His-tagged | +Inquiry |
CUZD1-1232H | Recombinant Human CUZD1 protein, GST-tagged | +Inquiry |
CUZD1-1339R | Recombinant Rat CUZD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cuzd1-1553R | Recombinant Rat Cuzd1 protein, His & GST-tagged | +Inquiry |
RFL24011MF | Recombinant Full Length Mouse Cub And Zona Pellucida-Like Domain-Containing Protein 1(Cuzd1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUZD1 Products
Required fields are marked with *
My Review for All CUZD1 Products
Required fields are marked with *
0
Inquiry Basket