Recombinant Human CUZD1 protein, GST-tagged

Cat.No. : CUZD1-1232H
Product Overview : Recombinant Human CUZD1 protein(523-568 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 523-568 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : DISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQPFNS
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CUZD1 CUB and zona pellucida-like domains 1 [ Homo sapiens ]
Official Symbol CUZD1
Synonyms ERG-1; UO-44
Gene ID 50624
mRNA Refseq NM_022034.5
Protein Refseq NP_071317.2
UniProt ID Q86UP6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CUZD1 Products

Required fields are marked with *

My Review for All CUZD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon