Recombinant Human CUL7 Protein, GST-tagged

Cat.No. : CUL7-2137H
Product Overview : Human CUL7 partial ORF ( AAH33647, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a component of an E3 ubiquitin-protein ligase complex. The encoded protein interacts with TP53, CUL9, and FBXW8 proteins. Defects in this gene are a cause of 3M syndrome type 1 (3M1). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]
Molecular Mass : 36.63 kDa
AA Sequence : MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CUL7 cullin 7 [ Homo sapiens ]
Official Symbol CUL7
Synonyms CUL7; cullin 7; KIAA0076; cullin-7; dJ20C7.5; CUL-7;
Gene ID 9820
mRNA Refseq NM_001168370
Protein Refseq NP_001161842
MIM 609577
UniProt ID Q14999

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CUL7 Products

Required fields are marked with *

My Review for All CUL7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon