Recombinant Human CUL7 Protein, GST-tagged
Cat.No. : | CUL7-2137H |
Product Overview : | Human CUL7 partial ORF ( AAH33647, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a component of an E3 ubiquitin-protein ligase complex. The encoded protein interacts with TP53, CUL9, and FBXW8 proteins. Defects in this gene are a cause of 3M syndrome type 1 (3M1). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CUL7 cullin 7 [ Homo sapiens ] |
Official Symbol | CUL7 |
Synonyms | CUL7; cullin 7; KIAA0076; cullin-7; dJ20C7.5; CUL-7; |
Gene ID | 9820 |
mRNA Refseq | NM_001168370 |
Protein Refseq | NP_001161842 |
MIM | 609577 |
UniProt ID | Q14999 |
◆ Recombinant Proteins | ||
CUL7-2137H | Recombinant Human CUL7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUL7 Products
Required fields are marked with *
My Review for All CUL7 Products
Required fields are marked with *
0
Inquiry Basket