Recombinant Human CTRL, His-tagged

• Cat.No.: CTRL-69H
• Product Overview: Recombinant Human Chymotrypsin-Like Protease CTRL-1/CTRL produced by transfected human cells is a secreted protein with sequence (Ile33-Asn264) of Human CTRL fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 33-264 a.a.
• Description: Chymotrypsin-Like Protease CTRL-1 is a protease that belongs to the peptidase S1 family. Human CTRL-1 is synthesized as a 264 amino acid (aa) precursor that contains an 18 aa signal sequence, 15 aa activation peptide and a 231 aa mature chain. CTRL-1 Contains 1 peptidase S1 domain. It has many molecular functions, such as hydrolase, protease, and serine protease. CTRL-1 plays a role in digest and hydrolyze proteins in biological process.
• Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0
• AA Sequence: CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRH FVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEA LTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGD SGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYNVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.