Recombinant Human CTPS2 protein(191-330 aa), C-His-tagged

• Cat.No.: CTPS2-11H
• Product Overview: Recombinant Human CTPS2 protein(191-330 aa)(Q9NRF8), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 191-330 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: EQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINH
• Storage: Store at -20°C to -80°C for 12 months in lyophilized form. After reconstitution, if not intended for use within a month, aliquot and store at -80°C (Avoid repeated freezing and thawing). Lyophilized proteins are shipped at ambient temperature.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CTPS2 CTP synthase II [ Homo sapiens ]
• Official Symbol: CTPS2
• Synonyms: CTPS2; CTP synthase II; CTP synthase 2; CTP synthetase 2; UTP-ammonia ligase; CTP synthetase type 2; UTP--ammonia ligase 2; CTP synthetase isoform; cytidine 5-triphosphate synthetase 2; FLJ43358; MGC32997; DKFZp686C17207
• Gene ID: 56474
• mRNA Refseq: NM_001144002
• Protein Refseq: NP_001137474
• MIM: 300380
• UniProt ID: Q9NRF8