Recombinant Human CTNND2 Protein, GST-tagged

• Cat.No.: CTNND2-2089H
• Product Overview: Human CTNND2 partial ORF ( NP_001323, 1081 a.a. - 1190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an adhesive junction associated protein of the armadillo/beta-catenin superfamily and is implicated in brain and eye development and cancer formation. The protein encoded by this gene promotes the disruption of E-cadherin based adherens junction to favor cell spreading upon stimulation by hepatocyte growth factor. This gene is overexpressed in prostate adenocarcinomas and is associated with decreased expression of tumor suppressor E-cadherin in this tissue. This gene resides in a region of the short arm of chromosome 5 that is deleted in Cri du Chat syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013]
• Molecular Mass: 37.84 kDa
• AA Sequence: ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTNND2 catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein) [ Homo sapiens ]
• Official Symbol: CTNND2
• Synonyms: CTNND2; catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein); catenin delta-2; GT24; NPRAP; neurojungin; T-cell delta-catenin
• Gene ID: 1501
• mRNA Refseq: NM_001332
• Protein Refseq: NP_001323
• MIM: 604275
• UniProt ID: Q9UQB3