Recombinant Human CTGF, Fc-tagged

Cat.No. : CTGF-2606H
Product Overview : Recombinant Human CTGF is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln27-Ala349 ) of Human CTGF fused with a FC tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
Source : human cells
Species : Human
Tag : Fc
Form : Lyophilized from a 0.2 μM filtered solution of PBS,pH 7.4
AA Sequence : QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRK IGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL PGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRV TNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGV CTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMAVD DIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Protein length : 27-349 a.a.
Gene Name CTGF connective tissue growth factor [ Homo sapiens ]
Official Symbol CTGF
Synonyms CTGF; connective tissue growth factor; IGFBP8, CCN2; NOV2; HCS24; MGC102839; hypertrophic chondrocyte-specific protein 24; insulin-like growth factor-binding protein 8; OTTHUMP00000017213; Hypertrophic chondrocyte-specific protein 24
Gene ID 1490
mRNA Refseq NM_001901
Protein Refseq NP_001892
MIM 121009
UniProt ID P29279
Chromosome Location 6q23.1
Pathway Fatty acid, triacylglycerol, and ketone body metabolism; Hippo signaling pathway; PPARA activates gene expression
Function growth factor activity; heparin binding; insulin-like growth factor binding; integrin binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CTGF Products

Required fields are marked with *

My Review for All CTGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon