Recombinant Human CTDSP1 Protein, GST-tagged

• Cat.No.: CTDSP1-2060H
• Product Overview: Human CTDSP1 full-length ORF ( NP_872580.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the small C-terminal domain phosphatase (SCP) family of nuclear phosphatases. These proteins play a role in transcriptional regulation through specific dephosphorylation of phosphoserine 5 within tandem heptapeptide repeats of the C-terminal domain of RNA polymerase II. The encoded protein plays a role in neuronal gene silencing in non-neuronal cells, and may also inhibit osteoblast differentiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
• Molecular Mass: 55.5 kDa
• AA Sequence: MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTDSP1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 [ Homo sapiens ]
• Official Symbol: CTDSP1
• Synonyms: CTDSP1; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1; carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; NLIIF; nuclear LIM interactor interacting factor; SCP1; small CTD phosphatase 1; NLI-interacting factor 3; small C-terminal domain phosphatase 1; nuclear LIM interactor-interacting factor 3; NIF3; NLI-IF
• Gene ID: 58190
• mRNA Refseq: NM_001206878
• Protein Refseq: NP_001193807
• MIM: 605323
• UniProt ID: Q9GZU7