Recombinant Human CTBS Protein, GST-tagged

• Cat.No.: CTBS-2056H
• Product Overview: Human CTBS full-length ORF ( AAH24007.2, 37 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Chitobiase is a lysosomal glycosidase involved in degradation of asparagine-linked oligosaccharides on glycoproteins (Aronson and Kuranda, 1989 [PubMed 2531691]).[supplied by OMIM, Nov 2010]
• Molecular Mass: 33.22 kDa
• AA Sequence: DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTBS chitobiase, di-N-acetyl- [ Homo sapiens ]
• Official Symbol: CTBS
• Synonyms: CTBS; chitobiase, di-N-acetyl-; CTB; di-N-acetylchitobiase
• Gene ID: 1486
• mRNA Refseq: NM_004388
• Protein Refseq: NP_004379
• MIM: 600873
• UniProt ID: Q01459