Recombinant Human CT45A6 Protein, GST-tagged

• Cat.No.: CT45A6-2046H
• Product Overview: Human CT45-6 full-length ORF ( NP_001017438.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-189 a.a.
• Description: CT45A6 (Cancer/Testis Antigen Family 45 Member A6) is a Protein Coding gene. An important paralog of this gene is CT45A5.
• Molecular Mass: 47.19 kDa
• AA Sequence: MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CT45A6 cancer/testis antigen family 45 member A6 [ Homo sapiens (human) ]
• Official Symbol: CT45A6
• Synonyms: CT45A6; cancer/testis antigen family 45 member A6; Cancer/Testis Antigen Family 45 Member A6; Cancer/Testis Antigen CT45-6; Cancer/Testis Antigen 45-6; Cancer/Testis Antigen 45A6; CT45-6; Cancer/Testis Antigen Family 45 Member A4/A6; Cancer/Testis Antigen 45A4/45A6; Cancer/Testis Antigen 45-4/6; CT45.6; cancer/testis antigen family 45 member A6; cancer/testis antigen 45-4/6; cancer/testis antigen 45-6; cancer/testis antigen 45A4/45A6; cancer/testis antigen 45A6; cancer/testis antigen CT45-6; cancer/testis antigen family 45 member A4/A6
• Gene ID: 541465
• mRNA Refseq: NM_001017438
• Protein Refseq: NP_001017438
• MIM: 300797
• UniProt ID: P0DMU7