Recombinant Human CSPG5 Protein, GST-tagged

• Cat.No.: CSPG5-2015H
• Product Overview: Human CSPG5 partial ORF ( NP_006565, 445 a.a. - 539 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a proteoglycan that may function as a neural growth and differentiation factor. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.19 kDa
• AA Sequence: KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSPG5 chondroitin sulfate proteoglycan 5 (neuroglycan C) [ Homo sapiens ]
• Official Symbol: CSPG5
• Synonyms: CSPG5; chondroitin sulfate proteoglycan 5 (neuroglycan C); chondroitin sulfate proteoglycan 5; NGC; acidic leucine-rich EGF-like domain-containing brain protein; MGC44034
• Gene ID: 10675
• mRNA Refseq: NM_001206942
• Protein Refseq: NP_001193871
• MIM: 606775
• UniProt ID: O95196