Recombinant Human CSN3, His-tagged

• Cat.No.: CSN3-123H
• Product Overview: Recombinant Human κ-Casein/CSN3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Ala182) of Human CSN3 fused with a 6His tag at the C-terminus.

Specification

• Description: Kappa-Casein (CSN3) is a secreted protein that belongs to the Kappa-Casein family. CSN3 exists in heteromultimers that are composed of alpha-s 1casein and kappa casein linked by disulfide bonds. CSN3 is involved in a number of important physiological processes. In the gut, CSN3 protein is split into an insoluble peptide (para kappa-casein) and a soluble hydrophilic glycopeptide (caseinomacropeptide). Caseinomacropeptide is responsible for increased efficiency of digestion, prevention of neonate hypersensitivity to ingested proteins, and inhibition of gastric pathogens. Kappa-casein also stabilizes micelle formation, preventing casein precipitation in milk.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: EVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIAINNPCVPRTYYANPA VVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPAPATEP TVDSVVTPEAFSESIITSTPETTTVAVTPPTAVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Protein length: 21-182 a.a.

Gene Information

• Gene Name: CSN3 casein kappa [ Homo sapiens ]
• Official Symbol: CSN3
• Synonyms: CSN3; casein kappa; casein, kappa , CSN10; kappa-casein; KCA; CSNK; CSN10
• Gene ID: 1448
• mRNA Refseq: NM_005212
• Protein Refseq: NP_005203
• MIM: 601695
• UniProt ID: P07498
• Chromosome Location: 4q21.1