Recombinant Human CSF3R Protein, GST-tagged

• Cat.No.: CSF3R-1975H
• Product Overview: Human CSF3R partial ORF ( AAH53585, 25 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia. [provided by RefSeq, Aug 2010]
• Molecular Mass: 37.84 kDa
• AA Sequence: ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSF3R colony stimulating factor 3 receptor (granulocyte) [ Homo sapiens ]
• Official Symbol: CSF3R
• Synonyms: CSF3R; colony stimulating factor 3 receptor (granulocyte); CD114; granulocyte colony-stimulating factor receptor; GCSFR; G-CSF-R; CD114 antigen; G-CSF receptor
• Gene ID: 1441
• mRNA Refseq: NM_000760
• Protein Refseq: NP_000751
• MIM: 138971
• UniProt ID: Q99062