Recombinant Human CSF3, StrepII-tagged

• Cat.No.: CSF3-250H
• Product Overview: Purified, full-length human recombinant G-CSF or Granulocyte colony-stimulating factor protein (amino acids 30-207, 178 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.1 kDa. (Accession NP_000750.1; UniProt P09919)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 30-207, 178 a.a.
• Description: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes- macrophages. This CSF induces granulocytes.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGI SPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at °C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ]
• Official Symbol: CSF3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33
• Gene ID: 1440
• mRNA Refseq: NM_000759
• Protein Refseq: NP_000750
• MIM: 138970
• UniProt ID: P09919
• Chromosome Location: 17q11.2-q12
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine activity; cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity