Recombinant Human CSF3 Protein, GST-tagged
Cat.No. : | CSF3-1973H |
Product Overview : | Human CSF3 full-length ORF ( NP_000750.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010] |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ] |
Official Symbol | CSF3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
Gene ID | 1440 |
mRNA Refseq | NM_000759 |
Protein Refseq | NP_000750 |
MIM | 138970 |
UniProt ID | P09919 |
◆ Recombinant Proteins | ||
CSF3-4407C | Recombinant Chicken CSF3 Protein | +Inquiry |
CSF3-516H | Recombinant Human CSF3 protein | +Inquiry |
CSF3-01H | Recombinant Human Granulocyte Colony Stimulating Factor | +Inquiry |
CSF3-178M | Active Recombinant Mouse CSF3, MIgG2a Fc-tagged | +Inquiry |
Csf3-046M | Active Recombinant Mouse Csf3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket