Active Recombinant Mouse Csf3 Protein

• Cat.No.: Csf3-046M
• Product Overview: Purified recombinant protein of Mouse colony stimulating factor 3 (granulocyte) (Csf3) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
• Bio-activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2 x 10^7 units/mg.
• Molecular Mass: 19 kDa
• AA Sequence: MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Csf3 colony stimulating factor 3 (granulocyte) [ Mus musculus (house mouse) ]
• Official Symbol: Csf3
• Synonyms: Csf3; colony stimulating factor 3 (granulocyte); Csfg; G-CSF; MGI-IG; granulocyte colony-stimulating factor
• Gene ID: 12985
• mRNA Refseq: NM_009971
• Protein Refseq: NP_034101
• UniProt ID: P09920