Recombinant Human CSF2RA Protein, GST-tagged
Cat.No. : | CSF2RA-1971H |
Product Overview : | Human CSF2RA full-length ORF ( AAH02635.1, 1 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 69.74 kDa |
AA Sequence : | MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSF2RA colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) [ Homo sapiens ] |
Official Symbol | CSF2RA |
Synonyms | CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116; GMR-alpha; GMCSFR-alpha; CD116 antigen; GM-CSF receptor alpha subunit; colony stimulating factor 2 receptor alpha subunit; granulocyte-macrophage colony-stimulating factor receptor alpha chain; GMR; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; MGC3848; MGC4838; GM-CSF-R-alpha; |
Gene ID | 1438 |
mRNA Refseq | NM_001161529 |
Protein Refseq | NP_001155001 |
MIM | 306250 |
UniProt ID | P15509 |
◆ Recombinant Proteins | ||
CSF2RA-1971H | Recombinant Human CSF2RA Protein, GST-tagged | +Inquiry |
CSF2RA-1530H | Active Recombinant Human CSF2RA protein(Met1-Gly320), hFc-tagged | +Inquiry |
CSF2RA-497H | Recombinant Human CSF2RA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSF2RA-0899H | Recombinant Human CSF2RA Protein (Gln204-Pro360), N-His tagged | +Inquiry |
CSF2RA-2811H | Recombinant Human CSF2RA Protein (Glu23-Gly320), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2RA-2713HCL | Recombinant Human CSF2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF2RA Products
Required fields are marked with *
My Review for All CSF2RA Products
Required fields are marked with *
0
Inquiry Basket