Recombinant Human CSF2 Protein, Biotinylated

• Cat.No.: CSF2-492H
• Product Overview: Biotinylated Recombinant human CSF2 protein was tag free.

Specification

• Species: Human
• ProteinLength: 144
• Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. This gene plays a role in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been detected in SARS-CoV-2 infected patients that develop acute respiratory distress syndrome. Mice deficient in this gene or its receptor develop pulmonary alveolar proteinosis.
• Form: Lyophilized
• AA Sequence: MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens (human) ]
• Official Symbol: CSF2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897
• Gene ID: 1437
• mRNA Refseq: NM_000758
• Protein Refseq: NP_000749
• MIM: 138960
• UniProt ID: P04141