Recombinant Human CSAG3 Protein, GST-tagged
Cat.No. : | CSAG3-1955H |
Product Overview : | Human CSAG3 full-length ORF ( AAI60156.1, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CSAG3 (CSAG Family Member 3) is a Protein Coding gene. Diseases associated with CSAG3 include Chondrosarcoma. An important paralog of this gene is CSAG2. |
Molecular Mass : | 5.3 kDa |
AA Sequence : | MSRKPRASSPLSNNHPPTPKRRGSGRFPRQPGREKGPIKEVPGTKGSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSAG3 CSAG family member 3 [ Homo sapiens (human) ] |
Official Symbol | CSAG3 |
Synonyms | CSAG3; CSAG family member 3; CSAG Family Member 3; Taxol-Resistant-Associated Gene 3 Protein; Cancer/Testis Antigen 24.2; CSAG Family, Member 3A; CT24.2; CSAG3A; Chondrosarcoma-Associated Gene 2/3 Protein; Taxol Resistance Associated Gene 3; CSAG Family, Member 3; CSAG2 CSAG3; TRAG-3; TRAG3; chondrosarcoma-associated gene 2/3 protein; CSAG family, member 3A; cancer/testis antigen 24.2; taxol resistance associated gene 3; taxol-resistant-associated gene 3 protein |
Gene ID | 389903 |
mRNA Refseq | NM_001129826 |
Protein Refseq | NP_001123298 |
UniProt ID | Q9Y5P2 |
◆ Recombinant Proteins | ||
CSAG3-2149HF | Recombinant Full Length Human CSAG3 Protein, GST-tagged | +Inquiry |
CSAG3-3340H | Recombinant Human CSAG3 Protein, His-tagged | +Inquiry |
CSAG3-1955H | Recombinant Human CSAG3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSAG3 Products
Required fields are marked with *
My Review for All CSAG3 Products
Required fields are marked with *
0
Inquiry Basket