Recombinant Human CRTAC1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CRTAC1-239H |
Product Overview : | CRTAC1 MS Standard C13 and N15-labeled recombinant protein (NP_060528) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a glycosylated extracellular matrix protein that is found in the interterritorial matrix of articular deep zone cartilage. This protein is used as a marker to distinguish chondrocytes from osteoblasts and mesenchymal stem cells in culture. The presence of FG-GAP motifs and an RGD integrin-binding motif suggests that this protein may be involved in cell-cell or cell-matrix interactions. Copy number alterations in this gene have been observed in neurofibromatosis type 1-associated glomus tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 71.2 kDa |
AA Sequence : | MAPSADPGMSRMLPFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CRTAC1 cartilage acidic protein 1 [ Homo sapiens (human) ] |
Official Symbol | CRTAC1 |
Synonyms | CRTAC1; cartilage acidic protein 1; ASPIC1; CEP 68; FLJ10320; acidic secreted protein in cartilage; chondrocyte expressed protein 68 kDa CEP-68; ASPIC; CEP-68; |
Gene ID | 55118 |
mRNA Refseq | NM_018058 |
Protein Refseq | NP_060528 |
MIM | 606276 |
UniProt ID | Q9NQ79 |
◆ Recombinant Proteins | ||
CRTAC1-3925M | Recombinant Mouse CRTAC1 Protein | +Inquiry |
CRTAC1-1911H | Recombinant Human CRTAC1 Protein, GST-tagged | +Inquiry |
CRTAC1-11590H | Recombinant Human CRTAC1, GST-tagged | +Inquiry |
CRTAC1-001H | Recombinant Full Length Human CRTAC1 Protein, His Tagged | +Inquiry |
CRTAC1-7865H | Recombinant Human CRTAC1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTAC1-407HCL | Recombinant Human CRTAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRTAC1 Products
Required fields are marked with *
My Review for All CRTAC1 Products
Required fields are marked with *
0
Inquiry Basket