Recombinant Full Length Human CRTAC1 Protein, His Tagged
Cat.No. : | CRTAC1-001H |
Product Overview : | Recombinant Full Length Human CRTAC1 Protein (28-661 aa) with His Tag was expressed in HEK293. |
Availability | April 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 28-661 aa |
Description : | This gene encodes a glycosylated extracellular matrix protein that is found in the interterritorial matrix of articular deep zone cartilage. This protein is used as a marker to distinguish chondrocytes from osteoblasts and mesenchymal stem cells in culture. The presence of FG-GAP motifs and an RGD integrin-binding motif suggests that this protein may be involved in cell-cell or cell-matrix interactions. Copy number alterations in this gene have been observed in neurofibromatosis type 1-associated glomus tumors. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 70 kDa |
AA Sequence : | SQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSCHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.66 mg/mL by BCA |
Gene Name | CRTAC1 cartilage acidic protein 1 [ Homo sapiens (human) ] |
Official Symbol | CRTAC1 |
Synonyms | CRTAC1; cartilage acidic protein 1; ASPIC; CEP68; LOTUS; ASPIC1; CEP-68; cartilage acidic protein 1; acidic secreted protein in cartilage; chondrocyte expressed protein 68 kDa CEP-68 |
Gene ID | 55118 |
mRNA Refseq | NM_018058 |
Protein Refseq | NP_060528 |
MIM | 606276 |
UniProt ID | Q9NQ79 |
◆ Recombinant Proteins | ||
CRTAC1-3607C | Recombinant Chicken CRTAC1 | +Inquiry |
CRTAC1-3320H | Recombinant Human CRTAC1 Protein, MYC/DDK-tagged | +Inquiry |
Crtac1-2320M | Recombinant Mouse Crtac1 Protein, Myc/DDK-tagged | +Inquiry |
CRTAC1-001H | Recombinant Full Length Human CRTAC1 Protein, His Tagged | +Inquiry |
CRTAC1-1989M | Recombinant Mouse CRTAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTAC1-407HCL | Recombinant Human CRTAC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRTAC1 Products
Required fields are marked with *
My Review for All CRTAC1 Products
Required fields are marked with *
0
Inquiry Basket