Recombinant Human CRP Protein, GST-tagged

• Cat.No.: CRP-1904H
• Product Overview: Human CRP full-length ORF ( ENSP00000357093, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.8 kDa
• AA Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRP C-reactive protein, pentraxin-related [ Homo sapiens ]
• Official Symbol: CRP
• Synonyms: CRP; C-reactive protein, pentraxin-related; C-reactive protein; pentraxin 1; PTX1; MGC88244; MGC149895
• Gene ID: 1401
• mRNA Refseq: NM_000567
• Protein Refseq: NP_000558
• MIM: 123260
• UniProt ID: P02741