Recombinant Human CRISP2 Protein, GST-tagged
Cat.No. : | CRISP2-1882H |
Product Overview : | Human CRISP2 partial ORF ( NP_003287, 154 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CRISP2 (Cysteine Rich Secretory Protein 2) is a Protein Coding gene. Diseases associated with CRISP2 include Cholecystolithiasis and Orchitis. An important paralog of this gene is CRISP3. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | YCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRISP2 cysteine-rich secretory protein 2 [ Homo sapiens ] |
Official Symbol | CRISP2 |
Synonyms | CRISP2; cysteine-rich secretory protein 2; GAPDL5, testis specific protein 1 (probe H4 1 p3 1) , TPX1; cancer/testis antigen 36; CRISP 2; CT36; testis-specific protein TPX-1; testis specific protein 1 (probe H4-1 p3-1); glyceraldehyde-3-phosphate dehydrogenase-like 5; TPX1; TSP1; GAPDL5; CRISP-2; MGC111136; |
Gene ID | 7180 |
mRNA Refseq | NM_001142407 |
Protein Refseq | NP_001135879 |
MIM | 187430 |
UniProt ID | P16562 |
◆ Recombinant Proteins | ||
CRISP2-2213H | Recombinant Human CRISP2 Protein (Lys22-Asn240), N-His tagged | +Inquiry |
CRISP2-1980M | Recombinant Mouse CRISP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRISP2-3910M | Recombinant Mouse CRISP2 Protein | +Inquiry |
CRISP2-1882H | Recombinant Human CRISP2 Protein, GST-tagged | +Inquiry |
CRISP2-1442H | Recombinant Human CRISP2 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRISP2-7279HCL | Recombinant Human CRISP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRISP2 Products
Required fields are marked with *
My Review for All CRISP2 Products
Required fields are marked with *
0
Inquiry Basket