Recombinant Human CRISP2 Protein, GST-tagged

• Cat.No.: CRISP2-1882H
• Product Overview: Human CRISP2 partial ORF ( NP_003287, 154 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CRISP2 (Cysteine Rich Secretory Protein 2) is a Protein Coding gene. Diseases associated with CRISP2 include Cholecystolithiasis and Orchitis. An important paralog of this gene is CRISP3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.64 kDa
• AA Sequence: YCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRISP2 cysteine-rich secretory protein 2 [ Homo sapiens ]
• Official Symbol: CRISP2
• Synonyms: CRISP2; cysteine-rich secretory protein 2; GAPDL5, testis specific protein 1 (probe H4 1 p3 1) , TPX1; cancer/testis antigen 36; CRISP 2; CT36; testis-specific protein TPX-1; testis specific protein 1 (probe H4-1 p3-1); glyceraldehyde-3-phosphate dehydrogenase-like 5; TPX1; TSP1; GAPDL5; CRISP-2; MGC111136
• Gene ID: 7180
• mRNA Refseq: NM_001142407
• Protein Refseq: NP_001135879
• MIM: 187430
• UniProt ID: P16562