Recombinant Human CRIM1 Protein, GST-tagged

• Cat.No.: CRIM1-1873H
• Product Overview: Human CRIM1 partial ORF ( NP_057525, 36 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a transmembrane protein containing six cysteine-rich repeat domains and an insulin-like growth factor-binding domain. The encoded protein may play a role in tissue development though interactions with members of the transforming growth factor beta family, such as bone morphogenetic proteins. [provided by RefSeq, Nov 2010]
• Molecular Mass: 37.84 kDa
• AA Sequence: VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRIM1 reserved [ Homo sapiens ]
• Official Symbol: CRIM1
• Synonyms: CRIM1; reserved
• Gene ID: 51232
• mRNA Refseq: NM_016441
• Protein Refseq: NP_057525
• MIM: 606189
• UniProt ID: Q9NZV1