Recombinant Human CRHR1 Protein (24-121 aa), GST-tagged

• Cat.No.: CRHR1-424H
• Product Overview: Recombinant Human CRHR1 Protein (24-121 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Description: G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal bryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 37.9 kDa
• Protein length: 24-121 aa
• AA Sequence: SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: CRHR1 corticotropin releasing hormone receptor 1 [ Homo sapiens ]
• Official Symbol: CRHR1
• Synonyms: CRHR1; CRHR; CRF R; CRF1; CRF-R; CRFR1; CRF-R1; CRFR-1; CRH-R1; CRHR1L; CRHR1f; CRF-R-1; CRH-R-1; CRH-R1h
• Gene ID: 1394
• mRNA Refseq: NM_001145146
• Protein Refseq: NP_001138618
• MIM: 122561
• UniProt ID: P34998