Recombinant Human CRHBP Protein, GST-tagged

• Cat.No.: CRHBP-1865H
• Product Overview: Human CRHBP full-length ORF ( AAH18038, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]
• Molecular Mass: 61.16 kDa
• AA Sequence: MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRHBP corticotropin releasing hormone binding protein [ Homo sapiens ]
• Official Symbol: CRHBP
• Synonyms: CRHBP; corticotropin releasing hormone binding protein; corticotropin-releasing factor-binding protein; CRF BP; CRFBP; CRH-BP; CRF-binding protein; corticotropin releasing hormone-binding protein; corticotropin-releasing hormone-binding protein; CRF-BP
• Gene ID: 1393
• mRNA Refseq: NM_001882
• Protein Refseq: NP_001873
• MIM: 122559
• UniProt ID: P24387